Lineage for d3l71g_ (3l71 G:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1059389Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1059912Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) (S)
  5. 1059913Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins)
  6. 1059953Protein automated matches [191133] (1 species)
    not a true protein
  7. 1059954Species Chicken (Gallus gallus) [TaxId:9031] [189229] (4 PDB entries)
  8. 1059959Domain d3l71g_: 3l71 G: [180018]
    Other proteins in same PDB: d3l71f_, d3l71h_, d3l71j_, d3l71s_, d3l71u_, d3l71w_
    automated match to d1be3g_
    complexed with azo, bog, cdl, fes, gol, hec, hem, pee, uq

Details for d3l71g_

PDB Entry: 3l71 (more details), 2.84 Å

PDB Description: cytochrome bc1 complex from chicken with azoxystrobin bound
PDB Compounds: (G:) Mitochondrial ubiquinol-cytochrome c reductase ubiquinone-binding protein qp-c

SCOPe Domain Sequences for d3l71g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l71g_ f.23.13.1 (G:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
ihfgnlarvrhiityslspfeqraipnifsdalpnvwrrfssqvfkvappflgayllysw
gtqeferlkrknpadyendq

SCOPe Domain Coordinates for d3l71g_:

Click to download the PDB-style file with coordinates for d3l71g_.
(The format of our PDB-style files is described here.)

Timeline for d3l71g_: