Lineage for d3l71f_ (3l71 F:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1699236Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 1699237Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) (S)
    location - matrix side of the bc1 complex
    automatically mapped to Pfam PF02271
  5. 1699238Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
    probably important for the complex assembly, caps the matrix face of cytochrome b
  6. 1699268Protein automated matches [190325] (4 species)
    not a true protein
  7. 1699277Species Chicken (Gallus gallus) [TaxId:9031] [189228] (8 PDB entries)
  8. 1699282Domain d3l71f_: 3l71 F: [180017]
    Other proteins in same PDB: d3l71a1, d3l71a2, d3l71b1, d3l71b2, d3l71c1, d3l71c2, d3l71d1, d3l71g_, d3l71h_, d3l71j_, d3l71n1, d3l71n2, d3l71o1, d3l71o2, d3l71p1, d3l71p2, d3l71q1, d3l71q2, d3l71t_, d3l71u_, d3l71w_
    automated match to d1sqpf1
    complexed with azo, bog, cdl, fes, gol, hec, hem, pee, uq

Details for d3l71f_

PDB Entry: 3l71 (more details), 2.84 Å

PDB Description: cytochrome bc1 complex from chicken with azoxystrobin bound
PDB Compounds: (F:) Mitochondrial ubiquinol-cytochrome c reductase 14 kda protein

SCOPe Domain Sequences for d3l71f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l71f_ f.27.1.1 (F:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
grlmdrirkwyynaagfnkyglmrddtlyedddvkealkrlpedlynermfrikraldls
lkhrilpkeqwvkyeedkpylepylkevirerlereawnkk

SCOPe Domain Coordinates for d3l71f_:

Click to download the PDB-style file with coordinates for d3l71f_.
(The format of our PDB-style files is described here.)

Timeline for d3l71f_: