SCOPe 2.03: Domain d3l70g_: 3l70 G:

Lineage for d3l70g_ (3l70 G:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family)
   automatically mapped to Pfam PF02939

5. Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins)

6. Protein automated matches [191133] (1 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [189229] (4 PDB entries)

8. Domain d3l70g_: 3l70 G: [180010]
   Other proteins in same PDB: d3l70a1, d3l70a2, d3l70b1, d3l70b2, d3l70c1, d3l70c2, d3l70d1, d3l70d2, d3l70f_, d3l70h_, d3l70j_, d3l70n1, d3l70o1, d3l70o2, d3l70p1, d3l70p2, d3l70s_, d3l70u_, d3l70w_
   automated match to d1be3g_
   complexed with bog, cdl, fes, gol, hec, hem, jzv, pee, uq

Details for d3l70g_

PDB Entry: 3l70, 2.75 Å

PDB Description: cytochrome bc1 complex from chicken with trifloxystrobin bound

PDB Compounds: (G:) Mitochondrial ubiquinol-cytochrome c reductase ubiquinone-binding protein qp-c

SCOPe Domain Sequences for d3l70g_:

Sequence; same for both SEQRES and ATOM records:

>d3l70g_ f.23.13.1 (G:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
ihfgnlarvrhiityslspfeqraipnifsdalpnvwrrfssqvfkvappflgayllysw
gtqeferlkrknpadyendq

Timeline for d3l70g_:

• d3l70g_ first appeared in SCOPe 2.01
  
• d3l70g_ appears in SCOPe 2.02
  
• d3l70g_ appears in SCOPe 2.04
  
• d3l70g_ appears in the current release, SCOPe 2.08