SCOPe 2.08: Domain d3l5xa_: 3l5x A:

Lineage for d3l5xa_ (3l5x A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)

6. Protein Interleukin-13 (IL-13) [63532] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63533] (13 PDB entries)

8. Domain d3l5xa_: 3l5x A: [179989]
   Other proteins in same PDB: d3l5xh_, d3l5xl1, d3l5xl2
   automated match to d1ijza_
   complexed with gol, mes

Details for d3l5xa_

PDB Entry: 3l5x, 1.9 Å

PDB Description: crystal structure of the complex between il-13 and h2l6 fab

PDB Compounds: (A:) interleukin-13

SCOPe Domain Sequences for d3l5xa_:

Sequence, based on SEQRES records:

>d3l5xa_ a.26.1.2 (A:) Interleukin-13 (IL-13) {Human (Homo sapiens) [TaxId: 9606]}
stalrelieelvnitqnqkaplcngsmvwsinltagmycaaleslinvsgcsaiektqrm
lsgfcphkvsagqfsslhvrdtkievaqfvkdlllhlkklfregr

Sequence, based on observed residues (ATOM records):

>d3l5xa_ a.26.1.2 (A:) Interleukin-13 (IL-13) {Human (Homo sapiens) [TaxId: 9606]}
stalrelieelvnitqplcngsmvwsinltagmycaaleslinvsgcsaiektqrmlsgf
cphkvsagqfsslhvrdtkievaqfvkdlllhlkklfregr

Timeline for d3l5xa_:

• d3l5xa_ first appeared in SCOPe 2.01
  
• d3l5xa_ appears in SCOPe 2.07