SCOP 1.57: Domain d8icia1: 8ici A:9-91

Lineage for d8icia1 (8ici A:9-91)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.60: SAM domain-like [47768] (10 superfamilies)

4. Superfamily a.60.6: DNA polymerase beta, N-terminal (8 kD)-domain [47802] (1 family)

5. Family a.60.6.1: DNA polymerase beta, N-terminal (8 kD)-domain [47803] (1 protein)

6. Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47805] (90 PDB entries)

8. Domain d8icia1: 8ici A:9-91 [17998]
   Other proteins in same PDB: d8icia2

Details for d8icia1

PDB Entry: 8ici, 2.8 Å

PDB Description: dna polymerase beta (pol b) (e.c.2.7.7.7) complexed with seven base pairs of dna; soaked in the presence of dgtp (1 millimolar) and mgcl2 (5 millimolar)

SCOP Domain Sequences for d8icia1:

Sequence; same for both SEQRES and ATOM records:

>d8icia1 a.60.6.1 (A:9-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens)}
etlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk
iaekideflatgklrklekirqd

Timeline for d8icia1:

• d8icia1 first appeared (with stable ids) in SCOP 1.55
  
• d8icia1 appears in SCOP 1.59
  
• d8icia1 appears in the current release, SCOPe 2.08