Lineage for d3l3tg_ (3l3t G:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032519Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 3032520Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 3032521Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 3032711Protein automated matches [190046] (3 species)
    not a true protein
  7. 3032756Species Human (Homo sapiens) [TaxId:9606] [186911] (9 PDB entries)
  8. 3032760Domain d3l3tg_: 3l3t G: [179921]
    Other proteins in same PDB: d3l3ta_, d3l3tb_, d3l3tc_, d3l3td_
    automated match to d1aapa_
    complexed with ca, fmt

Details for d3l3tg_

PDB Entry: 3l3t (more details), 2.38 Å

PDB Description: Human mesotrypsin complexed with amyloid precursor protein inhibitor variant (APPIR15K)
PDB Compounds: (G:) Protein APP

SCOPe Domain Sequences for d3l3tg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l3tg_ g.8.1.1 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evcseqaetgpckamisrwyfdvtegkcapffyggcggnrnnfdteeycmavcgsai

SCOPe Domain Coordinates for d3l3tg_:

Click to download the PDB-style file with coordinates for d3l3tg_.
(The format of our PDB-style files is described here.)

Timeline for d3l3tg_: