SCOP 1.67: Domain d7icva1: 7icv A:9-91

Lineage for d7icva1 (7icv A:9-91)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.60: SAM domain-like [47768] (13 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)

6. Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
   topologically similar to the second domain

7. Species Human (Homo sapiens) [TaxId:9606] [47805] (92 PDB entries)

8. Domain d7icva1: 7icv A:9-91 [17992]
   Other proteins in same PDB: d7icva3, d7icva4
   protein/DNA complex; complexed with na

Details for d7icva1

PDB Entry: 7icv, 2.8 Å

PDB Description: dna polymerase beta (pol b) (e.c.2.7.7.7) complexed with six base pairs of dna; soaked in the presence of mncl2 (0.1 millimolar) and in the absence of nacl

SCOP Domain Sequences for d7icva1:

Sequence; same for both SEQRES and ATOM records:

>d7icva1 a.60.6.1 (A:9-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens)}
etlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk
iaekideflatgklrklekirqd

Timeline for d7icva1:

• d7icva1 first appeared (with stable ids) in SCOP 1.55
  
• d7icva1 appears in SCOP 1.65
  
• d7icva1 appears in SCOP 1.69
  
• d7icva1 appears in the current release, SCOPe 2.08