Class g: Small proteins [56992] (90 folds) |
Fold g.8: BPTI-like [57361] (1 superfamily) disulfide-rich alpha+beta fold |
Superfamily g.8.1: BPTI-like [57362] (4 families) |
Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins) |
Protein automated matches [190046] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186911] (4 PDB entries) |
Domain d3l3te_: 3l3t E: [179919] Other proteins in same PDB: d3l3ta_, d3l3tb_, d3l3tc_, d3l3td_ automated match to d1aapa_ complexed with ca, fmt |
PDB Entry: 3l3t (more details), 2.38 Å
SCOPe Domain Sequences for d3l3te_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l3te_ g.8.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evcseqaetgpckamisrwyfdvtegkcapffyggcggnrnnfdteeycmavcgsai
Timeline for d3l3te_: