Lineage for d3l3ca_ (3l3c A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908439Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1908745Protein Splicesomal U1A protein [54932] (2 species)
    duplication: contains two domains of this fold
  7. 1908750Species Human (Homo sapiens) [TaxId:9606] [54933] (48 PDB entries)
    Uniprot P09012 1-97 ! Uniprot P09012 4-98 ! Uniprot P09012 1-98
  8. 1908803Domain d3l3ca_: 3l3c A: [179902]
    automated match to d1urna_
    protein/RNA complex; complexed with g6p, mg

Details for d3l3ca_

PDB Entry: 3l3c (more details), 2.85 Å

PDB Description: crystal structure of the bacillus anthracis glms ribozyme bound to glc6p
PDB Compounds: (A:) U1 small nuclear ribonucleoprotein A

SCOPe Domain Sequences for d3l3ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l3ca_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}
rpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevssat
nalrsmqgfpfydkpmriqyaktdsdiiak

SCOPe Domain Coordinates for d3l3ca_:

Click to download the PDB-style file with coordinates for d3l3ca_.
(The format of our PDB-style files is described here.)

Timeline for d3l3ca_: