Lineage for d3l1ka_ (3l1k A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873305Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2873306Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2873307Family c.41.1.1: Subtilases [52744] (15 proteins)
  6. 2873369Protein Proteinase K [52762] (1 species)
  7. 2873370Species Fungus (Tritirachium album), strain limber [TaxId:37998] [52763] (153 PDB entries)
    Uniprot P06873
  8. 2873429Domain d3l1ka_: 3l1k A: [179856]
    automated match to d1ic6a_
    complexed with ca, edo, so4, te6

Details for d3l1ka_

PDB Entry: 3l1k (more details), 1.55 Å

PDB Description: SAD structure solution of proteinase K grown in potassium tellurate solution
PDB Compounds: (A:) Proteinase K

SCOPe Domain Sequences for d3l1ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l1ka_ c.41.1.1 (A:) Proteinase K {Fungus (Tritirachium album), strain limber [TaxId: 37998]}
aaqtnapwglarisstspgtstyyydesagqgscvyvidtgieashpefegraqmvktyy
yssrdgnghgthcagtvgsrtygvakktqlfgvkvlddngsgqystiiagmdfvasdknn
rncpkgvvaslslgggysssvnsaaarlqssgvmvavaagnnnadarnyspasepsvctv
gasdrydrrssfsnygsvldifgpgtdilstwiggstrsisgtsmatphvaglaaylmtl
gkttaasacryiadtankgdlsnipfgtvnllaynnyqa

SCOPe Domain Coordinates for d3l1ka_:

Click to download the PDB-style file with coordinates for d3l1ka_.
(The format of our PDB-style files is described here.)

Timeline for d3l1ka_: