SCOPe 2.08: Domain d3l0lb_: 3l0l B:

Lineage for d3l0lb_ (3l0l B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.0: automated matches [191623] (1 protein)
   not a true family

6. Protein automated matches [191142] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189274] (121 PDB entries)

8. Domain d3l0lb_: 3l0l B: [179843]
   automated match to d1n83a_
   protein/DNA complex; complexed with hc3

Details for d3l0lb_

PDB Entry: 3l0l, 1.74 Å

PDB Description: crystal structure of orphan nuclear receptor rorgamma in complex with natural ligand

PDB Compounds: (B:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d3l0lb_:

Sequence; same for both SEQRES and ATOM records:

>d3l0lb_ a.123.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
peapyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwer
cahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffe
gkyggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkv
eqlqynlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafp
plykelfs

Timeline for d3l0lb_:

• d3l0lb_ first appeared in SCOPe 2.01
  
• d3l0lb_ appears in SCOPe 2.07