Lineage for d3kyva_ (3kyv A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262912Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2263118Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2263119Family g.41.5.1: Rubredoxin [57803] (5 proteins)
  6. 2263128Protein Rubredoxin [57804] (8 species)
  7. 2263189Species Pyrococcus furiosus [TaxId:2261] [57809] (28 PDB entries)
    Uniprot P24297
  8. 2263204Domain d3kyva_: 3kyv A: [179815]
    automated match to d1bq8a_
    complexed with dod, fe

Details for d3kyva_

PDB Entry: 3kyv (more details), 1.1 Å

PDB Description: Denovo X-ray crystal structure determination of H-labeled perdeuterated rubredoxin at 100K
PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d3kyva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kyva_ g.41.5.1 (A:) Rubredoxin {Pyrococcus furiosus [TaxId: 2261]}
makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled

SCOPe Domain Coordinates for d3kyva_:

Click to download the PDB-style file with coordinates for d3kyva_.
(The format of our PDB-style files is described here.)

Timeline for d3kyva_: