Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Protein kinase CK2, alpha subunit [56142] (3 species) CMGC group; CK2 subfamily; serine/threonine kinase |
Species Maize (Zea mays) [TaxId:4577] [56143] (31 PDB entries) |
Domain d3kxma_: 3kxm A: [179794] automated match to d1dawa_ complexed with k74 |
PDB Entry: 3kxm (more details), 1.75 Å
SCOPe Domain Sequences for d3kxma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kxma_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Maize (Zea mays) [TaxId: 4577]} skarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekci ikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvlyp tltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpgk eynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvkia kvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkllr ydhqerltaleamthpyfqqvraaen
Timeline for d3kxma_: