Lineage for d3kxma_ (3kxm A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2982560Protein Protein kinase CK2, alpha subunit [56142] (3 species)
    CMGC group; CK2 subfamily; serine/threonine kinase
  7. 2982813Species Maize (Zea mays) [TaxId:4577] [56143] (33 PDB entries)
  8. 2982835Domain d3kxma_: 3kxm A: [179794]
    automated match to d1dawa_
    complexed with k74

Details for d3kxma_

PDB Entry: 3kxm (more details), 1.75 Å

PDB Description: crystal structure of z. mays ck2 kinase alpha subunit in complex with the inhibitor k74
PDB Compounds: (A:) Casein kinase II subunit alpha

SCOPe Domain Sequences for d3kxma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kxma_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Maize (Zea mays) [TaxId: 4577]}
skarvyadvnvlrpkeywdyealtvqwgeqddyevvrkvgrgkysevfeginvnnnekci
ikilkpvkkkkikreikilqnlcggpnivklldivrdqhsktpslifeyvnntdfkvlyp
tltdydiryyiyellkaldychsqgimhrdvkphnvmidhelrklrlidwglaefyhpgk
eynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnhdqlvkia
kvlgtdglnvylnkyrieldpqlealvgrhsrkpwlkfmnadnqhlvspeaidfldkllr
ydhqerltaleamthpyfqqvraaen

SCOPe Domain Coordinates for d3kxma_:

Click to download the PDB-style file with coordinates for d3kxma_.
(The format of our PDB-style files is described here.)

Timeline for d3kxma_: