Lineage for d3kx9e_ (3kx9 E:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1484437Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1484438Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1484439Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1485319Protein automated matches [190041] (24 species)
    not a true protein
  7. 1485320Species Archaeoglobus fulgidus [TaxId:2234] [189565] (1 PDB entry)
  8. 1485325Domain d3kx9e_: 3kx9 E: [179772]
    automated match to d1s3qa1
    complexed with gol

Details for d3kx9e_

PDB Entry: 3kx9 (more details), 2.1 Å

PDB Description: engineering a closed form of the archaeoglobus fulgidus ferritin by site directed mutagenesis
PDB Compounds: (E:) Ferritin

SCOPe Domain Sequences for d3kx9e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kx9e_ a.25.1.1 (E:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
qwyvaeqveeeasaldiveklrligedaaallfldkelslrqf

SCOPe Domain Coordinates for d3kx9e_:

Click to download the PDB-style file with coordinates for d3kx9e_.
(The format of our PDB-style files is described here.)

Timeline for d3kx9e_: