Class a: All alpha proteins [46456] (284 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
Protein Cytochrome P450 bm-3 [48268] (1 species) |
Species Bacillus megaterium [TaxId:1404] [48269] (45 PDB entries) Uniprot P14779 |
Domain d3kx3b_: 3kx3 B: [179764] automated match to d1jpza_ complexed with 140, hem; mutant |
PDB Entry: 3kx3 (more details), 1.8 Å
SCOPe Domain Sequences for d3kx3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kx3b_ a.104.1.1 (B:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} kempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeac desrfdknlsqalkfvrdfagdgeftswtheknwkkahnillpsfsqqamkgyhammvdi avqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvrald eamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkd petgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpv psykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhr dktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfd fedhtnyeldiketltlkpegfvvkakskkiplggi
Timeline for d3kx3b_: