Class b: All beta proteins [48724] (178 folds) |
Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) two constituent families are related by circular permutation |
Family b.7.1.0: automated matches [191388] (1 protein) not a true family |
Protein automated matches [190497] (4 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [189223] (11 PDB entries) |
Domain d3kwta_: 3kwt A: [179759] automated match to d2ep6a1 complexed with b3p, cl |
PDB Entry: 3kwt (more details), 1.89 Å
SCOPe Domain Sequences for d3kwta_:
Sequence, based on SEQRES records: (download)
>d3kwta_ b.7.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} sakisitvvcaqglqakdktgssdpyvtvqvgktkkrtktiygnlnpvweenfhfechns sdrikvrvldedddiksrvkqrfkresddflgqtiievrtlsgemdvwynldkrtdksav sgairlhisvei
>d3kwta_ b.7.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} sakisitvvcaqglqakdgssdpyvtvqvgktkkrtktiygnlnpvweenfhfechnssd rikvrvldedddikesddflgqtiievrtlsgemdvwynldkrvsgairlhisvei
Timeline for d3kwta_: