SCOPe 2.08: Domain d3kwib_: 3kwi B:

Lineage for d3kwib_ (3kwi B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.299: Ns1 effector domain-like [143020] (1 superfamily)
   beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7]

4. Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family)
   automatically mapped to Pfam PF00600

5. Family d.299.1.1: Ns1 effector domain-like [143022] (2 proteins)
   C-terminal part of Pfam PF00600

6. Protein automated matches [190936] (7 species)
   not a true protein

7. Species Influenza A virus (a/udorn/307/1972(h3n2)) [TaxId:381517] [188730] (12 PDB entries)

8. Domain d3kwib_: 3kwi B: [179753]
   automated match to d2gx9a1
   mutant

Details for d3kwib_

PDB Entry: 3kwi, 2.21 Å

PDB Description: x-ray structure of ns1 effector domain w187y mutant

PDB Compounds: (B:) Non-structural protein 1

SCOPe Domain Sequences for d3kwib_:

Sequence; same for both SEQRES and ATOM records:

>d3kwib_ d.299.1.1 (B:) automated matches {Influenza A virus (a/udorn/307/1972(h3n2)) [TaxId: 381517]}
sryitdmtieelsrdwfmlmpkqkvegplciridqaimdknimlkanfsvifdrletlil
lrafteegaivgeisplpsfpghtiedvknaigvliggleyndntvrvsktlqrfaw

Timeline for d3kwib_:

• d3kwib_ first appeared in SCOPe 2.01
  
• d3kwib_ appears in SCOPe 2.07