![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (23 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.6: Ubiquitin carboxyl-terminal hydrolase UCH-L [54050] (3 proteins) |
![]() | Protein automated matches [191161] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189359] (4 PDB entries) |
![]() | Domain d3kw5a_: 3kw5 A: [179747] Other proteins in same PDB: d3kw5b_ automated match to d2etla1 complexed with gve |
PDB Entry: 3kw5 (more details), 2.83 Å
SCOPe Domain Sequences for d3kw5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kw5a_ d.3.1.6 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mqlkpmeinpemlnkvlsrlgvagqwrfvdvlgleeeslgsvpapacallllfpltaqhe nfrkkqieelkgqevspkvyfmkqtignscgtiglihavannqdklgfedgsvlkqflse tekmspedrakcfekneaiqaahdavaqegqcrvddkvnfhfilfnnvdghlyeldgrmp fpvnhgassedtllkdaakvcreftereqgevrfsavalckaa
Timeline for d3kw5a_: