Lineage for d3kvvf_ (3kvv F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2887828Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2888268Protein Uridine phosphorylase [53176] (6 species)
  7. 2888269Species Escherichia coli [TaxId:562] [53177] (16 PDB entries)
  8. 2888277Domain d3kvvf_: 3kvv F: [179745]
    automated match to d1k3fa_
    complexed with r2b, so4, urf

Details for d3kvvf_

PDB Entry: 3kvv (more details), 1.8 Å

PDB Description: trapping of an oxocarbenium ion intermediate in up crystals
PDB Compounds: (F:) Uridine phosphorylase

SCOPe Domain Sequences for d3kvvf_:

Sequence, based on SEQRES records: (download)

>d3kvvf_ c.56.2.1 (F:) Uridine phosphorylase {Escherichia coli [TaxId: 562]}
sdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpvi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
aplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshavk
ivveaarrll

Sequence, based on observed residues (ATOM records): (download)

>d3kvvf_ c.56.2.1 (F:) Uridine phosphorylase {Escherichia coli [TaxId: 562]}
sdvfhlgltkndlqgatlaivpgdpdrvekiaalmdkpvklashrefttwraeldgkpvi
vcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslhf
aplefpavadfecttalveaaksigatthvgvtassdtfypgqerydtysgrvvrhfkgs
meewqamgvmnyemesatlltmcasqglragmvagvivnrtqeshavkivveaarrll

SCOPe Domain Coordinates for d3kvvf_:

Click to download the PDB-style file with coordinates for d3kvvf_.
(The format of our PDB-style files is described here.)

Timeline for d3kvvf_: