Lineage for d3kvsb_ (3kvs B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1253686Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1255931Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 1256091Protein automated matches [190531] (8 species)
    not a true protein
  7. 1256127Species Red algae (Galdieria sulphuraria) [TaxId:130081] [188789] (2 PDB entries)
  8. 1256129Domain d3kvsb_: 3kvs B: [179739]
    automated match to d1phnb_
    complexed with bla

Details for d3kvsb_

PDB Entry: 3kvs (more details), 1.5 Å

PDB Description: The high resolution structure of C-Phycocyanin from Galdieria Sulphuraria
PDB Compounds: (B:) C-phycocyanin beta chain

SCOPe Domain Sequences for d3kvsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kvsb_ a.1.1.3 (B:) automated matches {Red algae (Galdieria sulphuraria) [TaxId: 130081]}
ldafakvvaqadargeflsntqldalskmvsegnkrldvvnritsnasaivtnaaralfs
eqpqliqpggnaytnrrmaaclrdmeiilryvsyaiiagdssvlddrclnglretyqalg
vpgasvavgvekmkdsaiaiandpsgittgdcsalmaevgtyfdraatav

SCOPe Domain Coordinates for d3kvsb_:

Click to download the PDB-style file with coordinates for d3kvsb_.
(The format of our PDB-style files is described here.)

Timeline for d3kvsb_: