SCOPe 2.05: Domain d3kvsa_: 3kvs A:

Lineage for d3kvsa_ (3kvs A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
   oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
   binds a bilin chromophore
   automatically mapped to Pfam PF00502

6. Protein automated matches [190531] (16 species)
   not a true protein

7. Species Red algae (Galdieria sulphuraria) [TaxId:130081] [188789] (2 PDB entries)

8. Domain d3kvsa_: 3kvs A: [179738]
   automated match to d1phna_
   complexed with bla

Details for d3kvsa_

PDB Entry: 3kvs, 1.5 Å

PDB Description: The high resolution structure of C-Phycocyanin from Galdieria Sulphuraria

PDB Compounds: (A:) C-phycocyanin alpha chain

SCOPe Domain Sequences for d3kvsa_:

Sequence; same for both SEQRES and ATOM records:

>d3kvsa_ a.1.1.3 (A:) automated matches {Red algae (Galdieria sulphuraria) [TaxId: 130081]}
ktpiteaiaaadnqgrflsntelqavngryqraaasleaarsltsnaqrlingaaqavys
kfpytsqmpgpqyassavgkakcardigyylrmvtyclvvggtgpmdeyliagleeinrt
fdlspswyvealnyvksnhglsgqaaneantyidyainals

Timeline for d3kvsa_:

• d3kvsa_ first appeared in SCOPe 2.01
  
• d3kvsa_ appears in SCOPe 2.04
  
• d3kvsa_ appears in SCOPe 2.06
  
• d3kvsa_ appears in the current release, SCOPe 2.08