SCOPe 2.06: Domain d3kvqa_: 3kvq A:

Lineage for d3kvqa_ (3kvq A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d3kvqa_: 3kvq A: [179737]
   automated match to d1fhga_

Details for d3kvqa_

PDB Entry: 3kvq, 2.7 Å

PDB Description: Crystal structure of VEGFR2 extracellular domain D7

PDB Compounds: (A:) Vascular endothelial growth factor receptor 2

SCOPe Domain Sequences for d3kvqa_:

Sequence, based on SEQRES records:

>d3kvqa_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptitgnlenqttsigesievsctasgnpppqimwfkdnetlvedsgivlkdgnrnltirr
vrkedeglytcqacsvlgcakveaffiieg

Sequence, based on observed residues (ATOM records):

>d3kvqa_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptitgnlenqttsigesievsctaspqimwfkdnetlvedsgivlkdgnrnltirrvrke
deglytcqaccakveaffiieg

Timeline for d3kvqa_:

• d3kvqa_ first appeared in SCOPe 2.01
  
• d3kvqa_ appears in SCOPe 2.05
  
• d3kvqa_ appears in SCOPe 2.07
  
• d3kvqa_ appears in the current release, SCOPe 2.08