SCOPe 2.01: Domain d3kunb_: 3kun B:

Lineage for d3kunb_ (3kun B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Dehaloperoxidase [46530] (1 species)

7. Species Amphitrite ornata [TaxId:129555] [46531] (16 PDB entries)

8. Domain d3kunb_: 3kun B: [179717]
   automated match to d1ew6a_
   complexed with cyn, hem, so4

Details for d3kunb_

PDB Entry: 3kun, 1.26 Å

PDB Description: X-ray structure of the metcyano form of dehaloperoxidase from amphitrite ornata: evidence for photoreductive lysis of iron-cyanide bond

PDB Compounds: (B:) Dehaloperoxidase A

SCOPe Domain Sequences for d3kunb_:

Sequence; same for both SEQRES and ATOM records:

>d3kunb_ a.1.1.2 (B:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}
gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdantlvqmkqhsslttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

Timeline for d3kunb_:

• d3kunb_ is new in SCOPe 2.01-stable
  
• d3kunb_ appears in SCOPe 2.02
  
• d3kunb_ appears in the current release, SCOPe 2.08