Lineage for d3ku5a1 (3ku5 A:10-324)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2047495Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2047496Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2047543Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2047544Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2047584Species Influenza A virus, different strains [TaxId:11320] [49825] (116 PDB entries)
  8. 2047589Domain d3ku5a1: 3ku5 A:10-324 [179703]
    Other proteins in same PDB: d3ku5a2, d3ku5b_
    automated match to d1jsma_
    complexed with edo, nag, peg

Details for d3ku5a1

PDB Entry: 3ku5 (more details), 1.73 Å

PDB Description: crystal structure of a h2n2 influenza virus hemagglutinin, human like
PDB Compounds: (A:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d3ku5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ku5a1 b.19.1.2 (A:10-324) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
gdqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsiag
wllgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilpk
drwtqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvhh
pndeteqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvnglgsrmefswtlldmwdtin
festgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltig
ecpkyvkseklvlatglrnvp

SCOPe Domain Coordinates for d3ku5a1:

Click to download the PDB-style file with coordinates for d3ku5a1.
(The format of our PDB-style files is described here.)

Timeline for d3ku5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ku5a2
View in 3D
Domains from other chains:
(mouse over for more information)
d3ku5b_