Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (71 species) not a true protein |
Species Pseudoalteromonas atlantica [TaxId:342610] [189165] (1 PDB entry) |
Domain d3ktoa_: 3kto A: [179695] automated match to d1d5wb_ |
PDB Entry: 3kto (more details), 1.98 Å
SCOPe Domain Sequences for d3ktoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ktoa_ c.23.1.0 (A:) automated matches {Pseudoalteromonas atlantica [TaxId: 342610]} piiylvdhqkdaraalskllspldvtiqcfasaesfmrqqisddaigmiieahledkkds gielletlvkrgfhlptivmasssdiptavramrasaadfiekpfiehvlvhdvqqiing ak
Timeline for d3ktoa_: