SCOPe 2.06: Domain d3ktoa_: 3kto A:

Lineage for d3ktoa_ (3kto A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (71 species)
   not a true protein

7. Species Pseudoalteromonas atlantica [TaxId:342610] [189165] (1 PDB entry)

8. Domain d3ktoa_: 3kto A: [179695]
   automated match to d1d5wb_

Details for d3ktoa_

PDB Entry: 3kto, 1.98 Å

PDB Description: crystal structure of response regulator receiver protein from pseudoalteromonas atlantica

PDB Compounds: (A:) Response regulator receiver protein

SCOPe Domain Sequences for d3ktoa_:

Sequence; same for both SEQRES and ATOM records:

>d3ktoa_ c.23.1.0 (A:) automated matches {Pseudoalteromonas atlantica [TaxId: 342610]}
piiylvdhqkdaraalskllspldvtiqcfasaesfmrqqisddaigmiieahledkkds
gielletlvkrgfhlptivmasssdiptavramrasaadfiekpfiehvlvhdvqqiing
ak

Timeline for d3ktoa_:

• d3ktoa_ first appeared in SCOPe 2.01
  
• d3ktoa_ appears in SCOPe 2.05
  
• d3ktoa_ appears in SCOPe 2.07
  
• d3ktoa_ appears in the current release, SCOPe 2.08