Lineage for d1coo__ (1coo -)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.60: SAM domain-like [47768] (10 superfamilies) 
Superfamily a.60.3: C-terminal domain of RNA polymerase alpha subunit [47789] (1 family) 
Family a.60.3.1: C-terminal domain of RNA polymerase alpha subunit [47790] (1 protein) Protein C-terminal domain of RNA polymerase alpha subunit [47791] (2 species) 
Species Escherichia coli [TaxId:562] [47792] (1 PDB entry) 
Domain d1coo__: 1coo - [17967]
Details for d1coo__
PDB Entry: 1coo (more details)
PDB Description: the cooh-terminal domain of rna polymerase alpha subunit
SCOP Domain Sequences for d1coo__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1coo__ a.60.3.1 (-) C-terminal domain of RNA polymerase alpha subunit {Escherichia coli}
fdpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikdvla
srglslgmrlenwppasiade
SCOP Domain Coordinates for d1coo__:
Click to download the PDB-style file with coordinates for d1coo__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1coo__:
- d1coo__ first appeared (with stable ids) in SCOP 1.55
- d1coo__ appears in SCOP 1.59
- d1coo__ appears in the current release, SCOPe 2.08, called d1cooa_
View in 3D