Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.2: GAF domain-like [55781] (5 families) alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654 |
Family d.110.2.0: automated matches [191507] (1 protein) not a true family |
Protein automated matches [190838] (19 species) not a true protein |
Species Staphylococcus aureus [TaxId:282458] [189340] (4 PDB entries) |
Domain d3ksgb_: 3ksg B: [179654] automated match to d1vhma_ complexed with sme |
PDB Entry: 3ksg (more details), 2.3 Å
SCOPe Domain Sequences for d3ksgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ksgb_ d.110.2.0 (B:) automated matches {Staphylococcus aureus [TaxId: 282458]} ttinptnytllkkqaasliedehhmiailsnmsallndnldqinwvgfylleqnelilgp fqghpasvhipigkgvcgtavserrtqvvadvhqfkghiacdanskseivvpifkddkii gvldidapitdrfddndkehleaivkiiekqla
Timeline for d3ksgb_: