Lineage for d1dgta1 (1dgt A:401-581)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 282277Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 282321Superfamily a.60.2: RuvA domain 2-like [47781] (3 families) (S)
    duplication: contains two helix-hairpin-helix (HhH) motifs
  5. 282346Family a.60.2.2: NAD+-dependent DNA ligase, domain 3 [47786] (1 protein)
  6. 282347Protein NAD+-dependent DNA ligase, domain 3 [47787] (1 species)
    duplication: consists of two RuvA-like domains (four HhH motifs); also contains a zinc-finger subdomain
  7. 282348Species Thermus filiformis [TaxId:276] [47788] (2 PDB entries)
  8. 282351Domain d1dgta1: 1dgt A:401-581 [17965]
    Other proteins in same PDB: d1dgta2, d1dgta3, d1dgtb2, d1dgtb3, d1dgtb4

Details for d1dgta1

PDB Entry: 1dgt (more details), 2.9 Å

PDB Description: crystal structure of nad+-dependent dna ligase

SCOP Domain Sequences for d1dgta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dgta1 a.60.2.2 (A:401-581) NAD+-dependent DNA ligase, domain 3 {Thermus filiformis}
rwpeacpecghrlvkegkvhrcpnplcpakrfeairhyasrkamdieglgeklierllek
glvrdvadlyhlrkedllglermgeksaqnllrqieeskhrglerllyalglpgvgevla
rnlarrfgtmdrlleasleelieveevgeltarailetlkdpafrdlvrrlkeagvsmes
k

SCOP Domain Coordinates for d1dgta1:

Click to download the PDB-style file with coordinates for d1dgta1.
(The format of our PDB-style files is described here.)

Timeline for d1dgta1: