Lineage for d3krdg_ (3krd G:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437613Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1437614Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1437785Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1439158Protein automated matches [190144] (7 species)
    not a true protein
  7. 1439456Species Mycobacterium tuberculosis [TaxId:1773] [187707] (9 PDB entries)
  8. 1439549Domain d3krdg_: 3krd G: [179600]
    automated match to d1q5qh_
    complexed with feb

Details for d3krdg_

PDB Entry: 3krd (more details), 2.5 Å

PDB Description: Crystal Structure of Mycobacterium Tuberculosis Proteasome in complex with Fellutamide B
PDB Compounds: (G:) Proteasome subunit beta

SCOPe Domain Sequences for d3krdg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3krdg_ d.153.1.4 (G:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs

SCOPe Domain Coordinates for d3krdg_:

Click to download the PDB-style file with coordinates for d3krdg_.
(The format of our PDB-style files is described here.)

Timeline for d3krdg_: