Lineage for d3kqia1 (3kqi A:1-69)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2588901Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
    dimetal(zinc)-bound alpha+beta fold
  4. 2588902Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 2588925Family g.50.1.2: PHD domain [57911] (14 proteins)
  6. 2588974Protein automated matches [190654] (2 species)
    not a true protein
  7. 2588975Species Human (Homo sapiens) [TaxId:9606] [188436] (5 PDB entries)
  8. 2588976Domain d3kqia1: 3kqi A:1-69 [179559]
    Other proteins in same PDB: d3kqia2
    automated match to d1wepa_
    complexed with cl, gol, mg, zn

Details for d3kqia1

PDB Entry: 3kqi (more details), 1.78 Å

PDB Description: crystal structure of phf2 phd domain complexed with h3k4me3 peptide
PDB Compounds: (A:) PHD finger protein 2

SCOPe Domain Sequences for d3kqia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kqia1 g.50.1.2 (A:1-69) automated matches {Human (Homo sapiens) [TaxId: 9606]}
matvpvycvcrlpydvtrfmiecdackdwfhgscvgveeeeapdidiyhcpncekthgks
tlkkkrtwh

SCOPe Domain Coordinates for d3kqia1:

Click to download the PDB-style file with coordinates for d3kqia1.
(The format of our PDB-style files is described here.)

Timeline for d3kqia1: