Class a: All alpha proteins [46456] (289 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) duplication: contains two helix-hairpin-helix (HhH) motifs |
Family a.60.2.1: DNA helicase RuvA subunit, middle domain [47782] (1 protein) |
Protein DNA helicase RuvA subunit, middle domain [47783] (3 species) tetramer; binds Holliday junction |
Species Escherichia coli [TaxId:562] [47784] (5 PDB entries) |
Domain d1bdxc2: 1bdx C:65-142 [17953] Other proteins in same PDB: d1bdxa1, d1bdxa3, d1bdxb1, d1bdxb3, d1bdxc1, d1bdxc3, d1bdxd1, d1bdxd3 protein/DNA complex |
PDB Entry: 1bdx (more details), 6 Å
SCOPe Domain Sequences for d1bdxc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bdxc2 a.60.2.1 (C:65-142) DNA helicase RuvA subunit, middle domain {Escherichia coli [TaxId: 562]} nkqertlfkeliktngvgpklalailsgmsaqqfvnavereevgalvklpgigkktaerl ivemkdrfkglhgdlftp
Timeline for d1bdxc2: