SCOPe 2.06: Domain d3kmua_: 3kmu A:

Lineage for d3kmua_ (3kmu A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (25 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (882 PDB entries)

8. Domain d3kmua_: 3kmu A: [179459]
   automated match to d1byga_

Details for d3kmua_

PDB Entry: 3kmu, 1.8 Å

PDB Description: crystal structure of the ilk/alpha-parvin core complex (apo)

PDB Compounds: (A:) Integrin-linked kinase

SCOPe Domain Sequences for d3kmua_:

Sequence; same for both SEQRES and ATOM records:

>d3kmua_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hsgidfkqlnfltklnenhsgelwkgrwqgndivvkvlkvrdwstrksrdfneecprlri
fshpnvlpvlgacqsppaphptlithwmpygslynvlhegtnfvvdqsqavkfaldmarg
maflhtlepliprhalnsrsvmidedmtarismadvkfsfqspgrmyapawvapealqkk
pedtnrrsadmwsfavllwelvtrevpfadlsnmeigmkvaleglrptippgisphvskl
mkicmnedpakrpkfdmivpilekmqd

Timeline for d3kmua_:

• d3kmua_ first appeared in SCOPe 2.01
  
• d3kmua_ appears in SCOPe 2.05
  
• d3kmua_ appears in SCOPe 2.07
  
• d3kmua_ appears in the current release, SCOPe 2.08