SCOPe 2.08: Domain d3kmqa1: 3kmq A:1-470

Lineage for d3kmqa1 (3kmq A:1-470)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)

6. Protein Viral RNA polymerase [56695] (17 species)

7. Species Foot-and-mouth disease virus - type c [TaxId:12116] [187085] (9 PDB entries)

8. Domain d3kmqa1: 3kmq A:1-470 [179454]
   Other proteins in same PDB: d3kmqa2
   automated match to d1u09a_
   protein/RNA complex; mutant
   missing some secondary structures that made up less than one-third of the common domain

Details for d3kmqa1

PDB Entry: 3kmq, 2.11 Å

PDB Description: G62S mutant of foot-and-mouth disease virus RNA-polymerase in complex with a template- primer RNA, tetragonal structure

PDB Compounds: (A:) 3D polymerase

SCOPe Domain Sequences for d3kmqa1:

Sequence; same for both SEQRES and ATOM records:

>d3kmqa1 e.8.1.4 (A:1-470) Viral RNA polymerase {Foot-and-mouth disease virus - type c [TaxId: 12116]}
glivdtrdveervhvmrktklaptvahgvfnpefgpaalsnkdprlnegvvldevifskh
ksdtkmsaedkalfrrcaadyasrlhsvlgtanaplsiyeaikgvdgldamepdtapglp
walqgkrrgalidfengtvgpeveaalklmekreykfacqtflkdeirpmekvragktri
vdvlpvehilytrmmigrfcaqmhsnngpqigsavgcnpdvdwqrfgthfaqyrnvwdvd
ysafdanhcsdamnimfeevfrtefgfhpnaewilktlvntehayenkritveggmpsgc
satsiintilnniyvlyalrrhyegveldtytmisygddivvasdydldfealkphfksl
gqtitpadksdkgfvlghsitdvtflkrhfhmdygtgfykpvmasktleailsfarrgti
qeklisvaglavhsgpdeyrrlfepfqglfeipsyrslylrwvnavcgda

Timeline for d3kmqa1:

• d3kmqa1 first appeared in SCOPe 2.01, called d3kmqa_
  
• d3kmqa1 appears in SCOPe 2.07