Lineage for d1f0ma_ (1f0m A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 48649Fold a.60: SAM domain-like [47768] (10 superfamilies)
  4. 48650Superfamily a.60.1: SAM/Pointed domain [47769] (2 families) (S)
  5. 48655Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (3 proteins)
  6. 48663Protein EphB2 receptor [47776] (2 species)
  7. 48666Species Human (Homo sapiens) [TaxId:9606] [47777] (2 PDB entries)
  8. 48675Domain d1f0ma_: 1f0m A: [17942]

Details for d1f0ma_

PDB Entry: 1f0m (more details), 2.2 Å

PDB Description: monomeric structure of the human ephb2 sam (sterile alpha motif) domain

SCOP Domain Sequences for d1f0ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f0ma_ a.60.1.2 (A:) EphB2 receptor {Human (Homo sapiens)}
ytsfntvdewleaikmgqykesfanagftsfdvvsqmmmedilrvgvtlaghqkkilnsi
qvmraqmnqiq

SCOP Domain Coordinates for d1f0ma_:

Click to download the PDB-style file with coordinates for d1f0ma_.
(The format of our PDB-style files is described here.)

Timeline for d1f0ma_: