Lineage for d3kl2f1 (3kl2 F:36-235)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864173Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2864174Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2864227Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 2864228Protein automated matches [190499] (26 species)
    not a true protein
  7. 2864387Species Streptomyces avermitilis [TaxId:33903] [189136] (1 PDB entry)
  8. 2864393Domain d3kl2f1: 3kl2 F:36-235 [179416]
    Other proteins in same PDB: d3kl2a2, d3kl2b2, d3kl2c2, d3kl2d2, d3kl2e2, d3kl2f2, d3kl2g2, d3kl2k2, d3kl2l2
    automated match to d1j2ra_
    complexed with so4

Details for d3kl2f1

PDB Entry: 3kl2 (more details), 2.3 Å

PDB Description: crystal structure of a putative isochorismatase from streptomyces avermitilis
PDB Compounds: (F:) Putative isochorismatase

SCOPe Domain Sequences for d3kl2f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kl2f1 c.33.1.0 (F:36-235) automated matches {Streptomyces avermitilis [TaxId: 33903]}
leldpartaivlieyqneftsdggvlhgavadvmqhtgmlantvavvdaarqagvpimha
pitfaegygeltrhpygilkgvvdgkafvkgtwgaaivdelapvngdiviegkrgldtfa
stnldfilrskgvdtivlggfltnccvestmrtgyergfrvitltdcvaatsqeehnnai
sydfpmfsvpmtsadviaal

SCOPe Domain Coordinates for d3kl2f1:

Click to download the PDB-style file with coordinates for d3kl2f1.
(The format of our PDB-style files is described here.)

Timeline for d3kl2f1: