SCOPe 2.08: Domain d3kl2c1: 3kl2 C:37-235

Lineage for d3kl2c1 (3kl2 C:37-235)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families)

5. Family c.33.1.0: automated matches [191389] (1 protein)
   not a true family

6. Protein automated matches [190499] (26 species)
   not a true protein

7. Species Streptomyces avermitilis [TaxId:33903] [189136] (1 PDB entry)

8. Domain d3kl2c1: 3kl2 C:37-235 [179413]
   Other proteins in same PDB: d3kl2a2, d3kl2b2, d3kl2c2, d3kl2d2, d3kl2e2, d3kl2f2, d3kl2g2, d3kl2k2, d3kl2l2
   automated match to d1j2ra_
   complexed with so4

Details for d3kl2c1

PDB Entry: 3kl2, 2.3 Å

PDB Description: crystal structure of a putative isochorismatase from streptomyces avermitilis

PDB Compounds: (C:) Putative isochorismatase

SCOPe Domain Sequences for d3kl2c1:

Sequence; same for both SEQRES and ATOM records:

>d3kl2c1 c.33.1.0 (C:37-235) automated matches {Streptomyces avermitilis [TaxId: 33903]}
eldpartaivlieyqneftsdggvlhgavadvmqhtgmlantvavvdaarqagvpimhap
itfaegygeltrhpygilkgvvdgkafvkgtwgaaivdelapvngdiviegkrgldtfas
tnldfilrskgvdtivlggfltnccvestmrtgyergfrvitltdcvaatsqeehnnais
ydfpmfsvpmtsadviaal

Timeline for d3kl2c1:

• d3kl2c1 first appeared in SCOPe 2.01, called d3kl2c_
  
• d3kl2c1 appears in SCOPe 2.07