SCOPe 2.02: Domain d3kkop_: 3kko P:

Lineage for d3kkop_ (3kko P:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (16 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186896] (9 PDB entries)

8. Domain d3kkop_: 3kko P: [179406]
   automated match to d1x1ra1
   complexed with gnp, mg, so4

Details for d3kkop_

PDB Entry: 3kko, 1.9 Å

PDB Description: Crystal structure of M-Ras P40D/D41E/L51R in complex with GppNHp

PDB Compounds: (P:) Ras-related protein M-Ras

SCOPe Domain Sequences for d3kkop_:

Sequence; same for both SEQRES and ATOM records:

>d3kkop_ c.37.1.8 (P:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lptyklvvvgdggvgksaltiqffqkifvdeydptiedsyrkhteidnqwaildvldtag
qeefsamreqymrtgdgflivysvtdkasfehvdrfhqlilrvkdresfpmilvankvdl
mhlrkvtrdqgkematkynipyietsakdpplnvdktfhdlvrvirqq

Timeline for d3kkop_:

• d3kkop_ first appeared in SCOPe 2.01
  
• d3kkop_ appears in SCOPe 2.03
  
• d3kkop_ appears in the current release, SCOPe 2.08