Lineage for d3kkob_ (3kko B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 987698Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 988558Protein automated matches [190047] (13 species)
    not a true protein
  7. 988716Species Mouse (Mus musculus) [TaxId:10090] [186896] (7 PDB entries)
  8. 988724Domain d3kkob_: 3kko B: [179405]
    automated match to d1x1ra1
    complexed with gnp, mg, so4

Details for d3kkob_

PDB Entry: 3kko (more details), 1.9 Å

PDB Description: Crystal structure of M-Ras P40D/D41E/L51R in complex with GppNHp
PDB Compounds: (B:) Ras-related protein M-Ras

SCOPe Domain Sequences for d3kkob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kkob_ c.37.1.8 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nlptyklvvvgdggvgksaltiqffqkifvdeydptiedsyrkhteidnqwaildvldta
gqeefsamreqymrtgdgflivysvtdkasfehvdrfhqlilrvkdresfpmilvankvd
lmhlrkvtrdqgkematkynipyietsakdpplnvdktfhdlvrvirqq

SCOPe Domain Coordinates for d3kkob_:

Click to download the PDB-style file with coordinates for d3kkob_.
(The format of our PDB-style files is described here.)

Timeline for d3kkob_: