SCOPe 2.06: Domain d3kkma_: 3kkm A:

Lineage for d3kkma_ (3kkm A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (179 PDB entries)

8. Domain d3kkma_: 3kkm A: [179402]
   automated match to d1iaqa_
   complexed with gnp, mg, so4

Details for d3kkma_

PDB Entry: 3kkm, 1.7 Å

PDB Description: Crystal structure of H-Ras T35S in complex with GppNHp

PDB Compounds: (A:) gtpase hras

SCOPe Domain Sequences for d3kkma_:

Sequence, based on SEQRES records:

>d3kkma_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydpsiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh

Sequence, based on observed residues (ATOM records):

>d3kkma_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydpsiedsyrkqvvidgetclldildtag
mrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdlaartvesrqaq
dlarsygipyietsaktrqgvedafytlvreirqh

Timeline for d3kkma_:

• d3kkma_ first appeared in SCOPe 2.01
  
• d3kkma_ appears in SCOPe 2.05
  
• d3kkma_ appears in SCOPe 2.07
  
• d3kkma_ appears in the current release, SCOPe 2.08