Lineage for d3kkkd_ (3kkk D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890965Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2890966Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2890967Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)
  6. 2891019Protein automated matches [190196] (7 species)
    not a true protein
  7. 2891090Species Plasmodium falciparum [TaxId:36329] [189120] (1 PDB entry)
  8. 2891094Domain d3kkkd_: 3kkk D: [179401]
    automated match to d1xq9a_
    mutant

Details for d3kkkd_

PDB Entry: 3kkk (more details), 2.08 Å

PDB Description: y92c catalytic residue mutant of phosphoglycerate mutase from plasmodium falciparum
PDB Compounds: (D:) phosphoglycerate mutase

SCOPe Domain Sequences for d3kkkd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kkkd_ c.60.1.1 (D:) automated matches {Plasmodium falciparum [TaxId: 36329]}
ttytlvllrhgestwnkenkftgwtdvplsekgeeeaiaagkylkeknfkfdvvytsvlk
raictawnvlktadllhvpvvktwrlnerhcgslqglnksetakkygeeqvkiwrrsydi
pppkldkednrwpghnvvyknvpkdalpfteclkdtvervlpfwfdhiapdilankkvmv
aahgnslrglvkhldnlseadvlelniptgvplvyeldenlkpikhyyll

SCOPe Domain Coordinates for d3kkkd_:

Click to download the PDB-style file with coordinates for d3kkkd_.
(The format of our PDB-style files is described here.)

Timeline for d3kkkd_: