SCOPe 2.05: Domain d3ki4a_: 3ki4 A:

Lineage for d3ki4a_ (3ki4 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.0: automated matches [191650] (1 protein)
   not a true family

6. Protein automated matches [191197] (7 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [189511] (11 PDB entries)

8. Domain d3ki4a_: 3ki4 A: [179381]
   automated match to d1aerb_
   complexed with g9p, gol

Details for d3ki4a_

PDB Entry: 3ki4, 1.65 Å

PDB Description: catalytic fragment of cholix toxin from vibrio cholerae in complex with inhibitor gp-p

PDB Compounds: (A:) Cholix toxin

SCOPe Domain Sequences for d3ki4a_:

Sequence, based on SEQRES records:

>d3ki4a_ d.166.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
hmavitpqgvtnwtyqeleathqaltregyvfvgyhgtnhvaaqtivnriapvprgnnte
neekwgglyvathaevahgyarikegtgeyglptraerdargvmlrvyipraslerfyrt
ntplenaeehitqvighslplrneaftgpesaggedetvigwdmaihavaipstipgnay
eelaideeavakeqsistkppyke

Sequence, based on observed residues (ATOM records):

>d3ki4a_ d.166.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
hmavitpqgvtnwtyqeleathqaltregyvfvgyhgtnhvaaqtivnriapvteneekw
gglyvathaevahgyarikegtgeyglptraerdargvmlrvyipraslerfyrtntple
naeehitqvighslplrneaftgpesaggedetvigwdmaihavaipstipgnayeelai
deeavakeqsistkppyke

Timeline for d3ki4a_:

• d3ki4a_ first appeared in SCOPe 2.01
  
• d3ki4a_ appears in SCOPe 2.04
  
• d3ki4a_ is called d3ki4a1 in SCOPe 2.06
  
• d3ki4a_ appears in the current release, SCOPe 2.08, called d3ki4a1