Lineage for d1b0xa_ (1b0x A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 48649Fold a.60: SAM domain-like [47768] (10 superfamilies)
  4. 48650Superfamily a.60.1: SAM/Pointed domain [47769] (2 families) (S)
  5. 48655Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (3 proteins)
  6. 48660Protein EphA4 receptor tyrosine kinases [47774] (1 species)
  7. 48661Species Mouse (Mus musculus) [TaxId:10090] [47775] (1 PDB entry)
  8. 48662Domain d1b0xa_: 1b0x A: [17933]

Details for d1b0xa_

PDB Entry: 1b0x (more details), 2 Å

PDB Description: the crystal structure of an eph receptor sam domain reveals a mechanism for modular dimerization.

SCOP Domain Sequences for d1b0xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0xa_ a.60.1.2 (A:) EphA4 receptor tyrosine kinases {Mouse (Mus musculus)}
fsavvsvgdwlqaikmdrykdnftaagyttleavvhmsqddlarigitaithqnkilssv
qamrtqmqqmhg

SCOP Domain Coordinates for d1b0xa_:

Click to download the PDB-style file with coordinates for d1b0xa_.
(The format of our PDB-style files is described here.)

Timeline for d1b0xa_: