Lineage for d3kfca_ (3kfc A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2728875Protein Oxysterols receptor LXR-beta [89149] (1 species)
  7. 2728876Species Human (Homo sapiens) [TaxId:9606] [89150] (21 PDB entries)
    Uniprot P55055 219-461
  8. 2728893Domain d3kfca_: 3kfc A: [179327]
    automated match to d1p8da_
    protein/DNA complex; complexed with 61x

Details for d3kfca_

PDB Entry: 3kfc (more details), 2.4 Å

PDB Description: Complex Structure of LXR with an agonist
PDB Compounds: (A:) oxysterols receptor lxr-beta

SCOPe Domain Sequences for d3kfca_:

Sequence, based on SEQRES records: (download)

>d3kfca_ a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]}
ltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgadpqsrdarqqrfahftelaiisv
qeivdfakqvpgflqlgredqiallkastieimlletarrynhetecitflkdftyskdd
fhraglqvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqpy
veallsytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwd

Sequence, based on observed residues (ATOM records): (download)

>d3kfca_ a.123.1.1 (A:) Oxysterols receptor LXR-beta {Human (Homo sapiens) [TaxId: 9606]}
ltaaqelmiqqlvaaqlqcnkrsfsdqpkvtpwplgdarqqrfahftelaiisvqeivdf
akqvpgflqlgredqiallkastieimlletarrynhetecitflkdftyskddfhragl
qvefinpifefsramrrlglddaeyalliainifsadrpnvqepgrvealqqpyvealls
ytrikrpqdqlrfprmlmklvslrtlssvhseqvfalrlqdkklppllseiwd

SCOPe Domain Coordinates for d3kfca_:

Click to download the PDB-style file with coordinates for d3kfca_.
(The format of our PDB-style files is described here.)

Timeline for d3kfca_: