SCOPe 2.05: Domain d3keed_: 3kee D:

Lineage for d3keed_ (3kee D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.3: Viral proteases [50596] (5 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein automated matches [190658] (4 species)
   not a true protein

7. Species Hepatitis C virus [TaxId:11103] [189262] (8 PDB entries)

8. Domain d3keed_: 3kee D: [179303]
   automated match to d1a1qa_
   complexed with 30b, gol, zn

Details for d3keed_

PDB Entry: 3kee, 2.4 Å

PDB Description: HCV NS3/NS4A complexed with Non-covalent macrocyclic compound TMC435

PDB Compounds: (D:) Genome polyprotein

SCOPe Domain Sequences for d3keed_:

Sequence; same for both SEQRES and ATOM records:

>d3keed_ b.47.1.3 (D:) automated matches {Hepatitis C virus [TaxId: 11103]}
itaysqqtrgllgciitsltgrdknqvegevqvvstatqsflatcvngvcwtvyhgagsk
tlagpkgpitqmytnvdqdlvgwqappgarsltpctcgssdlylvtrhadvipvrrrgds
rgsllsprpvsylkgssggpllcpsghavgifraavctrgvakavdfvpvesmettmr

Timeline for d3keed_:

• d3keed_ first appeared in SCOPe 2.01
  
• d3keed_ appears in SCOPe 2.04
  
• d3keed_ appears in SCOPe 2.06
  
• d3keed_ appears in the current release, SCOPe 2.08