Lineage for d3kdbb_ (3kdb B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1796116Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1796117Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1796118Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 1796134Protein Human immunodeficiency virus type 1 protease [50632] (8 species)
  7. 1796358Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (446 PDB entries)
    Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167
  8. 1796635Domain d3kdbb_: 3kdb B: [179285]
    automated match to d1a30a_
    complexed with 006, gol

Details for d3kdbb_

PDB Entry: 3kdb (more details), 1.66 Å

PDB Description: crystal structure of hiv-1 protease (q7k, l33i, l63i) in complex with kni-10006
PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d3kdbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kdbb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
qiiieicghkaigtvlvgptpvniigrnlltqigctlnf

SCOPe Domain Coordinates for d3kdbb_:

Click to download the PDB-style file with coordinates for d3kdbb_.
(The format of our PDB-style files is described here.)

Timeline for d3kdbb_: