Lineage for d3kbxb_ (3kbx B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928974Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2928975Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2928976Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 2929310Protein automated matches [190403] (4 species)
    not a true protein
  7. 2929318Species Human (Homo sapiens) [TaxId:9606] [187277] (20 PDB entries)
  8. 2929340Domain d3kbxb_: 3kbx B: [179244]
    automated match to d1b50a_
    complexed with act, k

Details for d3kbxb_

PDB Entry: 3kbx (more details), 2.65 Å

PDB Description: human macrophage inflammatory protein-1 alpha l3m_v63m
PDB Compounds: (B:) ccl3

SCOPe Domain Sequences for d3kbxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kbxb_ d.9.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqkym
sdlels

SCOPe Domain Coordinates for d3kbxb_:

Click to download the PDB-style file with coordinates for d3kbxb_.
(The format of our PDB-style files is described here.)

Timeline for d3kbxb_: