Lineage for d3k9za_ (3k9z A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688797Species Sperm whale (Physeter catodon) [TaxId:9755] [188226] (7 PDB entries)
  8. 2688803Domain d3k9za_: 3k9z A: [179218]
    automated match to d104ma_
    complexed with fe2, hem

Details for d3k9za_

PDB Entry: 3k9z (more details), 1.72 Å

PDB Description: rational design of a structural and functional nitric oxide reductase
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d3k9za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3k9za_ a.1.1.2 (A:) automated matches {Sperm whale (Physeter catodon) [TaxId: 9755]}
vlsegewqlvlhvwakveadvaghgqdihirlfkshpetlekhdrfkhlkteaemkased
lkkhgvteltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

SCOPe Domain Coordinates for d3k9za_:

Click to download the PDB-style file with coordinates for d3k9za_.
(The format of our PDB-style files is described here.)

Timeline for d3k9za_: