SCOPe 2.06: Domain d3k98b1: 3k98 B:9-225

Lineage for d3k98b1 (3k98 B:9-225)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)

6. Protein HSP90 [55876] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55878] (93 PDB entries)
   Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223

8. Domain d3k98b1: 3k98 B:9-225 [179204]
   Other proteins in same PDB: d3k98a2, d3k98b2
   automated match to d1osfa_
   complexed with 1rc, po4

Details for d3k98b1

PDB Entry: 3k98, 2.4 Å

PDB Description: hsp90 n-terminal domain in complex with (1r)-2-(5-chloro-2,4- dihydroxybenzoyl)-n-ethylisoindoline-1-carboxamide

PDB Compounds: (B:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d3k98b1:

Sequence; same for both SEQRES and ATOM records:

>d3k98b1 d.122.1.1 (B:9-225) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
dqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdps
kldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadi
smigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvil
hlkedqteyleerrikeivkkhsqfigypitlfveke

Timeline for d3k98b1:

• d3k98b1 first appeared in SCOPe 2.01, called d3k98b_
  
• d3k98b1 was called d3k98b_ in SCOPe 2.05
  
• d3k98b1 appears in SCOPe 2.07
  
• d3k98b1 appears in the current release, SCOPe 2.08