Lineage for d3k98a1 (3k98 A:9-225)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537076Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2537077Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2537078Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2537079Protein HSP90 [55876] (3 species)
  7. 2537164Species Human (Homo sapiens) [TaxId:9606] [55878] (144 PDB entries)
    Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223
  8. 2537310Domain d3k98a1: 3k98 A:9-225 [179203]
    Other proteins in same PDB: d3k98a2, d3k98b2
    automated match to d1osfa_
    complexed with 1rc, po4

Details for d3k98a1

PDB Entry: 3k98 (more details), 2.4 Å

PDB Description: hsp90 n-terminal domain in complex with (1r)-2-(5-chloro-2,4- dihydroxybenzoyl)-n-ethylisoindoline-1-carboxamide
PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d3k98a1:

Sequence, based on SEQRES records: (download)

>d3k98a1 d.122.1.1 (A:9-225) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
dqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdps
kldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadi
smigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvil
hlkedqteyleerrikeivkkhsqfigypitlfveke

Sequence, based on observed residues (ATOM records): (download)

>d3k98a1 d.122.1.1 (A:9-225) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
dqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdps
kldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmeaadismig
qfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlke
dqteyleerrikeivkkhsqfigypitlfveke

SCOPe Domain Coordinates for d3k98a1:

Click to download the PDB-style file with coordinates for d3k98a1.
(The format of our PDB-style files is described here.)

Timeline for d3k98a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3k98a2